Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLX4 Rabbit Polyclonal Antibody (FITC)

DLX4 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BP1, DLX7, DLX8, DLX9, OFC15

UniProt

Q92988

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human DLX4

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: RTFSVSPCSPPLPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQM

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001925

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C2CD2 (NM_015500) Human Tagged Lenti ORF Clone
RC221577L4 10 µg

C2CD2 (NM_015500) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CDC42EP5 AAV siRNA Pooled Vector
15626161 1.0 µg

CDC42EP5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CLCN3 AAV Vector (Mouse) (CMV)
16252104 1 µg

CLCN3 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
Human GALNTL1 Recombinant Protein C-6 His Tag
MBS8432108-01 0.05 mg

Human GALNTL1 Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
Human GALNTL1 Recombinant Protein C-6 His Tag
MBS8432108-02 5x 0.05 mg

Human GALNTL1 Recombinant Protein C-6 His Tag

Sign In for Pricing
View Details
Uqcc2 (NM_026063) Mouse Recombinant Protein
E45M48895M5 20 µg

Uqcc2 (NM_026063) Mouse Recombinant Protein

Sign In for Pricing
View Details