Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E2F3 Rabbit Polyclonal Antibody (Biotin)

E2F3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

E2F-3

UniProt

Q68DT0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human E2F3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

49kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

CAH18140

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COQ9 Knockout 786-O Polyclonal Cells
ARG5616 1 Million

COQ9 Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
KCE1L, ID (KCNE1L, AMMECR2, Potassium voltage-gated channel subfamily E member 1-like protein, AMME syndrome candidate gene 2 protein) (MaxLight 550)
MBS6312188-01 0.1 mL

KCE1L, ID (KCNE1L, AMMECR2, Potassium voltage-gated channel subfamily E member 1-like protein, AMME syndrome candidate gene 2 protein) (MaxLight 550)

Sign In for Pricing
View Details
KCE1L, ID (KCNE1L, AMMECR2, Potassium voltage-gated channel subfamily E member 1-like protein, AMME syndrome candidate gene 2 protein) (MaxLight 550)
MBS6312188-02 5x 0.1 mL

KCE1L, ID (KCNE1L, AMMECR2, Potassium voltage-gated channel subfamily E member 1-like protein, AMME syndrome candidate gene 2 protein) (MaxLight 550)

Sign In for Pricing
View Details
Rabbit Anti-Histone H3 (Nuclear Loading Control) antibody
SL0349R-01 50 µL

Rabbit Anti-Histone H3 (Nuclear Loading Control) antibody

Sign In for Pricing
View Details
Rabbit Anti-Histone H3 (Nuclear Loading Control) antibody
SL0349R-02 100 µL

Rabbit Anti-Histone H3 (Nuclear Loading Control) antibody

Sign In for Pricing
View Details
Rabbit Anti-Histone H3 (Nuclear Loading Control) antibody
SL0349R-03 500 µL

Rabbit Anti-Histone H3 (Nuclear Loading Control) antibody

Sign In for Pricing
View Details