Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1 Rabbit Polyclonal Antibody (Biotin)

HMGB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HMG1, HMG3, HMG-1, SBP-1

UniProt

P09429

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HMGB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002119

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse MSP (Macrophage Stimulating Protein) ELISA Kit
MBS8821929-01 48 Well

Mouse MSP (Macrophage Stimulating Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse MSP (Macrophage Stimulating Protein) ELISA Kit
MBS8821929-02 96 Well

Mouse MSP (Macrophage Stimulating Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse MSP (Macrophage Stimulating Protein) ELISA Kit
MBS8821929-03 5x 96 Well

Mouse MSP (Macrophage Stimulating Protein) ELISA Kit

Sign In for Pricing
View Details
Mouse MSP (Macrophage Stimulating Protein) ELISA Kit
MBS8821929-04 10x 96 Well

Mouse MSP (Macrophage Stimulating Protein) ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human CD158a Polyclonal Antibody
PA84758HU-01 50 µg

Rabbit Anti-Human CD158a Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human CD158a Polyclonal Antibody
PA84758HU-02 100 µg

Rabbit Anti-Human CD158a Polyclonal Antibody

Sign In for Pricing
View Details