Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1 Rabbit Polyclonal Antibody (Biotin)

HMGB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HMG1, HMG3, HMG-1, SBP-1

UniProt

P09429

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HMGB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKT

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002119

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Zfp358 Pre-designed siRNA Set B
SI216325B 1 Each

Rat Zfp358 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Lentiviral human ZNF417 sgRNA gene knockout kit - Lentiviral human ZNF417 sgRNA gene knockout kit (plasmid)
GTR15370952 1 Vial

Lentiviral human ZNF417 sgRNA gene knockout kit - Lentiviral human ZNF417 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (MaxLight 490)
247193-ML490 100 µL

HOXA5 (Homeobox A5, HOX1, HOX1.3, HOX1C, MGC9376) (MaxLight 490)

Sign In for Pricing
View Details
ASMTL Protein Vector (Human) (pPM-N-D-C-His)
PV324369 500 ng

ASMTL Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GDP-mannose 3,5-epimerase (At5g28840)
MBS1399719-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana GDP-mannose 3,5-epimerase (At5g28840)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana GDP-mannose 3,5-epimerase (At5g28840)
MBS1399719-02 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana GDP-mannose 3,5-epimerase (At5g28840)

Sign In for Pricing
View Details