Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMGB1 Rabbit Polyclonal Antibody (Biotin)

HMGB1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

HMG1, HMG3, HMG-1, SBP-1

UniProt

P09429

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HMGB1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AKKLGEMWNNTAADDKQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGV

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002119

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prss44 Protein Vector (Rat) (pPB-N-His)
PV296643 500 ng

Prss44 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
HHV8 ORF K14 Rabbit pAb, AE conjugated
orb2850834 100 µL

HHV8 ORF K14 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
SNU-475 Cell Line
RWT-379 1x 10^6

SNU-475 Cell Line

Sign In for Pricing
View Details
PP2A alpha + beta Rabbit Polyclonal Antibody
orb101330-01 50 μL

PP2A alpha + beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PP2A alpha + beta Rabbit Polyclonal Antibody
orb101330-02 100 µL

PP2A alpha + beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PP2A alpha + beta Rabbit Polyclonal Antibody
orb101330-03 200 µL

PP2A alpha + beta Rabbit Polyclonal Antibody

Sign In for Pricing
View Details