Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hoxb1 Rabbit Polyclonal Antibody (Biotin)

Hoxb1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

G3V737

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Hoxb1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AYSAPTSFPPSSAPAVDSYAGESRYGGGLPSSALQQNSGYPVQQPPSSLG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

XP_220896

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MEF2C polyclonal antibody
BS78363-01 50 µL

MEF2C polyclonal antibody

Sign In for Pricing
View Details
MEF2C polyclonal antibody
BS78363-02 100 µL

MEF2C polyclonal antibody

Sign In for Pricing
View Details
Serine Racemase Polyclonal Antibody, Biotin Conjugated
bs-10474R-Biotin 100 µL

Serine Racemase Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
MTA1 (Metastasis-associated Protein MTA1) (MaxLight 405) discontinued
129950-ML405 100 µL

MTA1 (Metastasis-associated Protein MTA1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
LY96, CT (LY96, ESOP1, MD2, Lymphocyte antigen 96, ESOP-1, Protein MD-2) (MaxLight 750)
MBS6317668-01 0.1 mL

LY96, CT (LY96, ESOP1, MD2, Lymphocyte antigen 96, ESOP-1, Protein MD-2) (MaxLight 750)

Sign In for Pricing
View Details
LY96, CT (LY96, ESOP1, MD2, Lymphocyte antigen 96, ESOP-1, Protein MD-2) (MaxLight 750)
MBS6317668-02 5x 0.1 mL

LY96, CT (LY96, ESOP1, MD2, Lymphocyte antigen 96, ESOP-1, Protein MD-2) (MaxLight 750)

Sign In for Pricing
View Details