Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hpcal1 Rabbit Polyclonal Antibody (HRP)

Hpcal1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

N, V, Nvp3, NVL-3, NVP-3, Vnsl3, Vsnl3, VILIP3

UniProt

P62748

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_057886

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ornithine Decarboxylase (ODC) ELISA Kit
RD-ODC-Hu-01 96 Tests

Human Ornithine Decarboxylase (ODC) ELISA Kit

Sign In for Pricing
View Details
Human Ornithine Decarboxylase (ODC) ELISA Kit
RD-ODC-Hu-02 48 Tests

Human Ornithine Decarboxylase (ODC) ELISA Kit

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (SOX10/2311R), CF405S conjugate, 0.1mg/mL
BNC042311-500 1x 500 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
KDM1A Antibody
KC-18171-01 50 μL

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
KC-18171-02 100 µL

KDM1A Antibody

Sign In for Pricing
View Details
KDM1A Antibody
KC-18171-03 1 mL

KDM1A Antibody

Sign In for Pricing
View Details