Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HTLF Rabbit Polyclonal Antibody (FITC)

HTLF Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

HTLF

UniProt

Q6P4Q2

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HTLF

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: KRAETPGAEKIAGLSQIYKMGSLPEAVDAARPKATLVDSESADDELTNLN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acetyl-Histone H3 (Lys4) Rabbit Monoclonal Antibody
AG3815 50 µL

Acetyl-Histone H3 (Lys4) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
MTHFR sgRNA CRISPR Lentivector (Human) (Target 3)
K1360904 1.0 µg DNA

MTHFR sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to SCAN Domain Containing Protein 3 (SCAND3)
MBS2085589-01 0.1 mL

Cy3-Linked Polyclonal Antibody to SCAN Domain Containing Protein 3 (SCAND3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to SCAN Domain Containing Protein 3 (SCAND3)
MBS2085589-02 0.2 mL

Cy3-Linked Polyclonal Antibody to SCAN Domain Containing Protein 3 (SCAND3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to SCAN Domain Containing Protein 3 (SCAND3)
MBS2085589-03 0.5 mL

Cy3-Linked Polyclonal Antibody to SCAN Domain Containing Protein 3 (SCAND3)

Sign In for Pricing
View Details
Cy3-Linked Polyclonal Antibody to SCAN Domain Containing Protein 3 (SCAND3)
MBS2085589-04 1 mL

Cy3-Linked Polyclonal Antibody to SCAN Domain Containing Protein 3 (SCAND3)

Sign In for Pricing
View Details