Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUN Rabbit Polyclonal Antibody (HRP)

JUN Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

AP1, p39, AP-1, cJUN, c-Jun

UniProt

P05412

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JUN

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLK

Field of Research

Cancer Biology

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002219

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-14-3-3 gamma Rabbit Monoclonal Antibody
MA1007-.1 100 µL

Anti-14-3-3 gamma Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Nr1h2 (NM_009473) Mouse Recombinant Protein
TP507128 20 µg

Nr1h2 (NM_009473) Mouse Recombinant Protein

Sign In for Pricing
View Details
ACTB Rabbit Polyclonal Antibody (Biotin)
orb2126164 100 µL

ACTB Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
FCGBP Protein Vector (Mouse) (pPB-C-His)
PV178950 500 ng

FCGBP Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Collagenase NB 4G Proved Grade from Clostridium histolyticum
NB-17465-01 500 mg

Collagenase NB 4G Proved Grade from Clostridium histolyticum

Sign In for Pricing
View Details
ATG5 (ATG5 autophagy Related 5 Homolog (S. cerevisiae), APG5, APG5-LIKE, APG5L, ASP, hAPG5) (HRP)
243589-HRP 100 µL

ATG5 (ATG5 autophagy Related 5 Homolog (S. cerevisiae), APG5, APG5-LIKE, APG5L, ASP, hAPG5) (HRP)

Sign In for Pricing
View Details