Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aff3 Rabbit Polyclonal Antibody (Biotin)

Aff3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

La, LAF, Laf4, LAF-4, A730046J16, 3222402O04Rik

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine angiopoietin-like protein2 (ANGPTL2) ELISA Kit
EIA05045p 1 Kit

Porcine angiopoietin-like protein2 (ANGPTL2) ELISA Kit

Sign In for Pricing
View Details
ATXN2 Antibody, Biotin conjugated
CSB-PA859520LD01HU-01 50 µg

ATXN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
ATXN2 Antibody, Biotin conjugated
CSB-PA859520LD01HU-02 100 µg

ATXN2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
IQSEC1 Recombinant Protein Antigen
NBP1-81480PEP 0.1 mL

IQSEC1 Recombinant Protein Antigen

Sign In for Pricing
View Details
Frequenin (NCS1) Human shRNA Lentiviral Particle (Locus ID 23413)
TL317016V 500 µL Each

Frequenin (NCS1) Human shRNA Lentiviral Particle (Locus ID 23413)

Sign In for Pricing
View Details
1- (4-Acetylbenzenesulfonyl) piperidine-2-carboxylic acid
JHB24069-01 0.5 g

1- (4-Acetylbenzenesulfonyl) piperidine-2-carboxylic acid

Sign In for Pricing
View Details