Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aff3 Rabbit Polyclonal Antibody (Biotin)

Aff3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

La, LAF, Laf4, LAF-4, A730046J16, 3222402O04Rik

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC53 (m) : 293T Lysate
sc-119068 100 µg - 200 µL

CCDC53 (m) : 293T Lysate

Sign In for Pricing
View Details
[3- (Methylamino) phenyl]methanol hydrochloride
YGC03143-01 50 mg

[3- (Methylamino) phenyl]methanol hydrochloride

Sign In for Pricing
View Details
[3- (Methylamino) phenyl]methanol hydrochloride
YGC03143-02 0.5 g

[3- (Methylamino) phenyl]methanol hydrochloride

Sign In for Pricing
View Details
TTR Protein Vector (Human) (pPB-N-His)
PV044510 500 ng

TTR Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Rat Arl9 Pre-designed siRNA Set A
SI200939A 1 Each

Rat Arl9 Pre-designed siRNA Set A

Sign In for Pricing
View Details
D4S234E (DNA Segment on Chromosome 4 (unique) 234 Expressed Sequence, D4S234, NEEP21, NSG1, P21) (AP)
MBS6165445-01 0.1 mL

D4S234E (DNA Segment on Chromosome 4 (unique) 234 Expressed Sequence, D4S234, NEEP21, NSG1, P21) (AP)

Sign In for Pricing
View Details