Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aff3 Rabbit Polyclonal Antibody (FITC)

Aff3 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

La, LAF, Laf4, LAF-4, A730046J16, 3222402O04Rik

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CO040, CT (C15orf40, UPF0235 protein C15orf40) (MaxLight 750)
MBS6287436-01 0.1 mL

CO040, CT (C15orf40, UPF0235 protein C15orf40) (MaxLight 750)

Sign In for Pricing
View Details
CO040, CT (C15orf40, UPF0235 protein C15orf40) (MaxLight 750)
MBS6287436-02 5x 0.1 mL

CO040, CT (C15orf40, UPF0235 protein C15orf40) (MaxLight 750)

Sign In for Pricing
View Details
TNF siRNA (Mouse)
MBS8201527-01 15 nmol

TNF siRNA (Mouse)

Sign In for Pricing
View Details
TNF siRNA (Mouse)
MBS8201527-02 30 nmol

TNF siRNA (Mouse)

Sign In for Pricing
View Details
TNF siRNA (Mouse)
MBS8201527-03 5x 30 nmol

TNF siRNA (Mouse)

Sign In for Pricing
View Details
Ddr2, CT (Ddr2, Ntrkr3, Tkt, Tyro10, Discoidin domain-containing receptor 2, CD167 antigen-like family member B, Neurotrophic tyrosine kinase, receptor-related 3, Receptor protein-tyrosine kinase TKT, Tyrosine-protein kinase TYRO10, CD167b) (MaxLight 550)
MBS6291328-01 0.1 mL

Ddr2, CT (Ddr2, Ntrkr3, Tkt, Tyro10, Discoidin domain-containing receptor 2, CD167 antigen-like family member B, Neurotrophic tyrosine kinase, receptor-related 3, Receptor protein-tyrosine kinase TKT, Tyrosine-protein kinase TYRO10, CD167b) (MaxLight 550)

Sign In for Pricing
View Details