Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Aff3 Rabbit Polyclonal Antibody (HRP)

Aff3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

La, LAF, Laf4, LAF-4, A730046J16, 3222402O04Rik

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TNSILHSYDYWEMADNLAKENREFFNDLDLLMGPVTLHSSMEHLVQYSQQ

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_034808

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C9orf25 (FAM219A) Human shRNA Plasmid Kit (Locus ID 203259)
TL305730 1 Kit

C9orf25 (FAM219A) Human shRNA Plasmid Kit (Locus ID 203259)

Sign In for Pricing
View Details
POTEA CRISPRa sgRNA lentivector (set of three targets)(Human)
37242121 3x 1.0µg DNA

POTEA CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
SHE10 Antibody
orb849909 2 mg

SHE10 Antibody

Sign In for Pricing
View Details
AKAP12 Protein Lysate
OCOA12781-20UG 20 µg

AKAP12 Protein Lysate

Sign In for Pricing
View Details
Lentiviral mouse Tcap shRNA (UAS) - Lentiviral mouse Tcap shRNA (UAS) (25)
GTR15109661 1 Vial

Lentiviral mouse Tcap shRNA (UAS) - Lentiviral mouse Tcap shRNA (UAS) (25)

Sign In for Pricing
View Details
TRIM17 siRNA (Mouse)
MBS8209111-01 15 nmol

TRIM17 siRNA (Mouse)

Sign In for Pricing
View Details