Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmo3 Rabbit Polyclonal Antibody (Biotin)

Lmo3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Rbt, Rbtn, Lmo-3, Rbtn3, Rbtn-3, AI854781, BB106490

UniProt

Q8BZL8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKAN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_997105

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Chymotrypsin-Like Elastase Family Member 1 (ELA1) ELISA Kit
MBS9931811 Inquire

Goat Chymotrypsin-Like Elastase Family Member 1 (ELA1) ELISA Kit

Sign In for Pricing
View Details
Anti-Hu CD45 PerCP-Cy™5.5
T9-222-T025 25 Tests

Anti-Hu CD45 PerCP-Cy™5.5

Sign In for Pricing
View Details
HGRM7 full length protein-synthetic nanodisc
orb2707993-01 10 µg

HGRM7 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
HGRM7 full length protein-synthetic nanodisc
orb2707993-02 50 µg

HGRM7 full length protein-synthetic nanodisc

Sign In for Pricing
View Details
PARP10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1596308 1.0 µg DNA

PARP10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Anti-Human LTA/TNF-beta Antibody (SAA0416), PE
MBS1582476-01 50 Tests

Anti-Human LTA/TNF-beta Antibody (SAA0416), PE

Sign In for Pricing
View Details