Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lmo3 Rabbit Polyclonal Antibody (HRP)

Lmo3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Rbt, Rbtn, Lmo-3, Rbtn3, Rbtn-3, AI854781, BB106490

UniProt

Q8BZL8

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PKGCAGCNRKIKDRYLLKALDKYWHEDCLKCACCDCRLGEVGSTLYTKAN

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_997105

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal ROBO1 Antibody (Asclepius Technology patent anti-Robo1 CAR) [Janelia Fluor 585]
NBP3-28772JF585 0.1 mL

Human Monoclonal ROBO1 Antibody (Asclepius Technology patent anti-Robo1 CAR) [Janelia Fluor 585]

Sign In for Pricing
View Details
Anti-PI3 Kinase p110 Delta/PIK3CD Antibody Picoband® Cy3 Conjugated
A02269-2-Cy3 100 µg/Vial

Anti-PI3 Kinase p110 Delta/PIK3CD Antibody Picoband® Cy3 Conjugated

Sign In for Pricing
View Details
Human Fatty Acid Binding Protein 3 Muscle And Heart FABP3 ELISA Kit
BG-HUM10895 1 Each

Human Fatty Acid Binding Protein 3 Muscle And Heart FABP3 ELISA Kit

Sign In for Pricing
View Details
POU4F3 siRNA (Mouse)
CRM3173-01 15 nmol

POU4F3 siRNA (Mouse)

Sign In for Pricing
View Details
POU4F3 siRNA (Mouse)
CRM3173-02 30 nmol

POU4F3 siRNA (Mouse)

Sign In for Pricing
View Details
Recombinant Bacillus subtilis Uncharacterized protein ydgB (ydgB)
MBS1140411-01 0.02 mg (E-Coli)

Recombinant Bacillus subtilis Uncharacterized protein ydgB (ydgB)

Sign In for Pricing
View Details