Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LMX1B Rabbit Polyclonal Antibody (FITC)

LMX1B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

NPS1, FSGS10, LMX1.2

UniProt

Q6ISC9

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human LMX1B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: QSPYGSSDPFQQGLTPPQMPGNDSIFHDIDSDTSLTSLSDCFLGSSDVGS

Field of Research

Stem Cell & Developmental Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

42kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002307

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)
MBS1123630-01 0.02 mg (E-Coli)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)
MBS1123630-02 0.1 mg (E-Coli)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)
MBS1123630-03 0.02 mg (Yeast)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)
MBS1123630-04 0.1 mg (Yeast)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)
MBS1123630-05 0.02 mg (Baculovirus)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)
MBS1123630-06 1 mg (E-Coli)

Recombinant Arabidopsis thaliana Uncharacterized mitochondrial protein AtMg00600 (AtMg00600)

Sign In for Pricing
View Details