Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxd1 Rabbit Polyclonal Antibody (Biotin)

Mxd1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ma, Mad, Mad1, AW122478

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VDVDVDVDVDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034881

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RALGPS1 (NM_001190729) Human Over-expression Lysate
LS009649-100ug 100 µg

RALGPS1 (NM_001190729) Human Over-expression Lysate

Sign In for Pricing
View Details
OSTC siRNA (Mouse)
CRM6586-01 15 nmol

OSTC siRNA (Mouse)

Sign In for Pricing
View Details
OSTC siRNA (Mouse)
CRM6586-02 30 nmol

OSTC siRNA (Mouse)

Sign In for Pricing
View Details
ZFPM1 ORF Vector (Human) (pORF)
ORF036135 1.0 µg DNA

ZFPM1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Chapare Virus (CHAV)
FR540 100 Reactions

Chapare Virus (CHAV)

Sign In for Pricing
View Details
Poly (Dimethylsiloxane) Vinyl Terminated
OR1029918-01 25 g

Poly (Dimethylsiloxane) Vinyl Terminated

Sign In for Pricing
View Details