Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxd1 Rabbit Polyclonal Antibody (Biotin)

Mxd1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ma, Mad, Mad1, AW122478

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VDVDVDVDVDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034881

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ATP-binding cassette sub-family C member 11 (ABCC11) ELISA Kit
AE23121HU-01 48 Tests

Human ATP-binding cassette sub-family C member 11 (ABCC11) ELISA Kit

Sign In for Pricing
View Details
Human ATP-binding cassette sub-family C member 11 (ABCC11) ELISA Kit
AE23121HU-02 96 Tests

Human ATP-binding cassette sub-family C member 11 (ABCC11) ELISA Kit

Sign In for Pricing
View Details
Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II) (Biotin) discontinued
H2033-23-Biotin 100 µL

Herpes Simplex Virus I, II, Glycoprotein D (HSV I, II) (Biotin) discontinued

Sign In for Pricing
View Details
NEURL2 Rabbit Polyclonal Antibody
orb581734 100 µL

NEURL2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl-2 (BH3 Domain Specific) Antibody Blocking peptide
orb1457554 500 µg

Bcl-2 (BH3 Domain Specific) Antibody Blocking peptide

Sign In for Pricing
View Details
CSDE1 Knockout GIST-T1 Cell Line
ARG0244 1 Million

CSDE1 Knockout GIST-T1 Cell Line

Sign In for Pricing
View Details