Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxd1 Rabbit Polyclonal Antibody (FITC)

Mxd1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ma, Mad, Mad1, AW122478

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VDVDVDVDVDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATV

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034881

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H2BK1 Antibody
KC-18952-01 50 μL

H2BK1 Antibody

Sign In for Pricing
View Details
H2BK1 Antibody
KC-18952-02 100 µL

H2BK1 Antibody

Sign In for Pricing
View Details
H2BK1 Antibody
KC-18952-03 1 mL

H2BK1 Antibody

Sign In for Pricing
View Details
MTF1 Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF805437 100 µg

MTF1 Mouse Monoclonal Antibody [Clone ID: OTI1D3]

Sign In for Pricing
View Details
VRL1 (TRPV2) Mouse Monoclonal Antibody [Clone ID: OTI2G10]
CF813002 100 µg

VRL1 (TRPV2) Mouse Monoclonal Antibody [Clone ID: OTI2G10]

Sign In for Pricing
View Details
LHX5 Human Gene Knockout Kit (CRISPR)
KN418951 1 Kit

LHX5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details