Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxd1 Rabbit Polyclonal Antibody (HRP)

Mxd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ma, Mad, Mad1, AW122478

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VDVDVDVDVDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034881

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSV2 gG protein
30C-CP4104R 0.1 mg

HSV2 gG protein

Sign In for Pricing
View Details
Endothelial Lipase Blocking Peptide - (Dry Ice)
NB400-118PEP 0.05 mg

Endothelial Lipase Blocking Peptide - (Dry Ice)

Sign In for Pricing
View Details
F9, ID (F9, Coagulation factor IX, Christmas factor, Plasma thromboplastin component, Coagulation factor IXa light chain, Coagulation factor IXa heavy chain) (AP) discontinued
035312-AP 200 µL

F9, ID (F9, Coagulation factor IX, Christmas factor, Plasma thromboplastin component, Coagulation factor IXa light chain, Coagulation factor IXa heavy chain) (AP) discontinued

Sign In for Pricing
View Details
CDX1 Antibody Blocking Peptide
orb1500704 500 µg

CDX1 Antibody Blocking Peptide

Sign In for Pricing
View Details
GRIK2 Protein Lysate
OCOA04885-20UG 20 µg

GRIK2 Protein Lysate

Sign In for Pricing
View Details
PKM2 Polyclonal Antibody
bs-0101R-TR 20 µL

PKM2 Polyclonal Antibody

Sign In for Pricing
View Details