Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mxd1 Rabbit Polyclonal Antibody (HRP)

Mxd1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ma, Mad, Mad1, AW122478

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VDVDVDVDVDVEGTDYLNGDLGWSSSVSDSDERGSMQSLGSDEGYSSATV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

25kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_034881

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGFG1 Rabbit Polyclonal Antibody (Biotin)
orb459371 100 µL

AGFG1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Desiccator Plate 141mm PP
DES2010 1 Each

Desiccator Plate 141mm PP

Sign In for Pricing
View Details
IFITM3 (NM_021034) Human Tagged Lenti ORF Clone
RC201635L4 10 µg

IFITM3 (NM_021034) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Rhox2d shRNA (UAS) - Lentiviral mouse Rhox2d shRNA (UAS) plasmid
GTR15288307 1 Vial

Lentiviral mouse Rhox2d shRNA (UAS) - Lentiviral mouse Rhox2d shRNA (UAS) plasmid

Sign In for Pricing
View Details
Human Valosin Containing Protein (VCP) ELISA Kit
orb1662891-01 48 Tests

Human Valosin Containing Protein (VCP) ELISA Kit

Sign In for Pricing
View Details
Human Valosin Containing Protein (VCP) ELISA Kit
orb1662891-02 96 Tests

Human Valosin Containing Protein (VCP) ELISA Kit

Sign In for Pricing
View Details