Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAX Rabbit Polyclonal Antibody (HRP)

MAX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

BHLHd4

UniProt

P61244

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MAX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002373

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCX (Doublecortin, Lissencephalin-X, Lis-X, DC, DBCN, LISX, SCLH, XLIS) (Biotin)
MBS6413716-01 0.1 mL

DCX (Doublecortin, Lissencephalin-X, Lis-X, DC, DBCN, LISX, SCLH, XLIS) (Biotin)

Sign In for Pricing
View Details
DCX (Doublecortin, Lissencephalin-X, Lis-X, DC, DBCN, LISX, SCLH, XLIS) (Biotin)
MBS6413716-02 5x 0.1 mL

DCX (Doublecortin, Lissencephalin-X, Lis-X, DC, DBCN, LISX, SCLH, XLIS) (Biotin)

Sign In for Pricing
View Details
DHS Polyclonal Antibody
MBS9243408-01 0.1 mL

DHS Polyclonal Antibody

Sign In for Pricing
View Details
DHS Polyclonal Antibody
MBS9243408-02 5x 0.1 mL

DHS Polyclonal Antibody

Sign In for Pricing
View Details
PPP1R14BP5 3'UTR Luciferase Stable Cell Line
TU018668 1.0 mL

PPP1R14BP5 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
RPL30P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV779414 1.0 µg DNA

RPL30P4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details