Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MNAT1 Rabbit Polyclonal Antibody (HRP)

MNAT1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

MAT1, TFB3, CAP35, RNF66

UniProt

P51948

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MNAT1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA

Field of Research

Signal Transduction

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_002422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHL17 (Kelch-like protein 17) ELISA Kit
EH1820 96 Tests

Human KLHL17 (Kelch-like protein 17) ELISA Kit

Sign In for Pricing
View Details
GFP hsa-miR-627-5p AAV miRNA Vector
Amh1093800 500 ng

GFP hsa-miR-627-5p AAV miRNA Vector

Sign In for Pricing
View Details
SCA2 GeneProber Digoxigenin labeled Probe; 110 uL
40-2038-41 110 µL

SCA2 GeneProber Digoxigenin labeled Probe; 110 uL

Sign In for Pricing
View Details
ARMC8 Overexpression Lysate (Native) - (Dry Ice)
NBL1-07711 0.1 mg

ARMC8 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
AdmiRa-rno-miR-665-Off Virus
mr5598 1.0 mL

AdmiRa-rno-miR-665-Off Virus

Sign In for Pricing
View Details
6- (2,6-Dichlorophenyl) -8-methyl-2- (methylthio) pyrido[2,3-d]pyrimidin-7 (8H) -one
272052-01 2 mg

6- (2,6-Dichlorophenyl) -8-methyl-2- (methylthio) pyrido[2,3-d]pyrimidin-7 (8H) -one

Sign In for Pricing
View Details