Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYC Rabbit Polyclonal Antibody (Biotin)

MYC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MRTL, MYCC, c-Myc, bHLHe39

UniProt

P01106

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MYC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MDFFRVVENQQPPATMPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQ

Field of Research

Cell Biology

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

19kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

IHC, WB

NCBI Accession Number

AAA88092

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB2 Protein Vector (Rat) (pPM-C-HA)
PV254860 500 ng

ASB2 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
Alg12 (NM_145477) Mouse Tagged Lenti ORF Clone
MR206021L4 10 µg

Alg12 (NM_145477) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TDGF1 Antibody
7099-002mg 0.02 mg

TDGF1 Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Chromogranin A Antibody (LK2H10 + PHE5) [Dylight 594]
NBP2-34673DL594 0.1 mL

Mouse Monoclonal Chromogranin A Antibody (LK2H10 + PHE5) [Dylight 594]

Sign In for Pricing
View Details
LIMA1, NT (LIMA1, EPLIN, SREBP3, LIM domain and actin-binding protein 1, Epithelial protein lost in neoplasm) (MaxLight 650)
MBS6316116-01 0.1 mL

LIMA1, NT (LIMA1, EPLIN, SREBP3, LIM domain and actin-binding protein 1, Epithelial protein lost in neoplasm) (MaxLight 650)

Sign In for Pricing
View Details
LIMA1, NT (LIMA1, EPLIN, SREBP3, LIM domain and actin-binding protein 1, Epithelial protein lost in neoplasm) (MaxLight 650)
MBS6316116-02 5x 0.1 mL

LIMA1, NT (LIMA1, EPLIN, SREBP3, LIM domain and actin-binding protein 1, Epithelial protein lost in neoplasm) (MaxLight 650)

Sign In for Pricing
View Details