Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MYC Rabbit Polyclonal Antibody (Biotin)

MYC Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MRTL, MYCC, c-Myc, bHLHe39

UniProt

Q6LBK7

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MYC

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NEKAPKVVILKKATAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLRN

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

7kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

CAA46984

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatitis A Virus Antibody
OAMA00339-1MG 1 mg

Hepatitis A Virus Antibody

Sign In for Pricing
View Details
Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit
MBS2505916-01 24 Tests

Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit
MBS2505916-02 48 Tests

Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit
MBS2505916-03 96 Tests

Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit
MBS2505916-04 5x 96 Tests

Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit

Sign In for Pricing
View Details
Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit
MBS2505916-05 10x 96 Tests

Guinea pig ADIPOR1 (Adiponectin Receptor 1) ELISA Kit

Sign In for Pricing
View Details