Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eif5 Rabbit Polyclonal Antibody (FITC)

Eif5 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q07205

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VKAEPFIKWLKEAEEESSGGEEEDEDENIEVVYSKTASVPKVETVKSDNK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Yeast

Tested Applications

WB

NCBI Accession Number

NP_064460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF152 (B-3) : m-IgG Fc BP-HRP Bundle
sc-538433 1 Kit

RNF152 (B-3) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
DTL, ID (DTL, CDT2, CDW1, DCAF2, L2DTL, RAMP, Denticleless protein homolog, DDB1- and CUL4-associated factor 2, Lethal (2) denticleless protein homolog, Retinoic acid-regulated nuclear matrix-associated protein) (MaxLight 650) discontinued
034834-ML650 100 µL

DTL, ID (DTL, CDT2, CDW1, DCAF2, L2DTL, RAMP, Denticleless protein homolog, DDB1- and CUL4-associated factor 2, Lethal (2) denticleless protein homolog, Retinoic acid-regulated nuclear matrix-associated protein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
N- (4- (Benzyloxy) Benzylidene) -4-Fluoroaniline
PC105367-01 1 g

N- (4- (Benzyloxy) Benzylidene) -4-Fluoroaniline

Sign In for Pricing
View Details
N- (4- (Benzyloxy) Benzylidene) -4-Fluoroaniline
PC105367-02 5 g

N- (4- (Benzyloxy) Benzylidene) -4-Fluoroaniline

Sign In for Pricing
View Details
N- (4- (Benzyloxy) Benzylidene) -4-Fluoroaniline
PC105367-03 25 g

N- (4- (Benzyloxy) Benzylidene) -4-Fluoroaniline

Sign In for Pricing
View Details
N- (4- (Benzyloxy) Benzylidene) -4-Fluoroaniline
PC105367-04 100 g

N- (4- (Benzyloxy) Benzylidene) -4-Fluoroaniline

Sign In for Pricing
View Details