Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfic Rabbit Polyclonal Antibody (Biotin)

Nfic Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

NF1-, NF1-C, AA589446, AI746521, 1110019L22Rik, 1500041O16Rik

UniProt

P70255

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Nfic

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: FNLQARKRKYFKKHEKRMSKDEERAVKDELLGEKAEVKQKWASRLLAKLR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat, Sheep, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse dynorphin, Dyn ELISA KIT
E0982Mo-01 48 Well

Mouse dynorphin, Dyn ELISA KIT

Sign In for Pricing
View Details
Mouse dynorphin, Dyn ELISA KIT
E0982Mo-02 96 Well

Mouse dynorphin, Dyn ELISA KIT

Sign In for Pricing
View Details
Mouse dynorphin, Dyn ELISA KIT
E0982Mo-03 5x 96 Tests

Mouse dynorphin, Dyn ELISA KIT

Sign In for Pricing
View Details
Mouse dynorphin, Dyn ELISA KIT
E0982Mo-04 10x 96 Tests

Mouse dynorphin, Dyn ELISA KIT

Sign In for Pricing
View Details
Mouse Angiotensin I (AngI) ELISA Kit
QY-E21748 96 Tests

Mouse Angiotensin I (AngI) ELISA Kit

Sign In for Pricing
View Details
Anti-DEFA6 (2D2)
YF-MA20318 100 ug

Anti-DEFA6 (2D2)

Sign In for Pricing
View Details