Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCB1 Rabbit Polyclonal Antibody (FITC)

SMARCB1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

RDT, CSS3, INI1, SNF5, Snr1, BAF47, MRD15, RTPS1, Sfh1p, hSNFS, SNF5L1, SWNTS1, PPP1R144

UniProt

Q12824

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human SMARCB1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWR

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001007469.1

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Monoclonal Antibody to Interleukin 1 Receptor Antagonist (IL1RA)
TRV-0021897-01 100 µL

FITC-Linked Monoclonal Antibody to Interleukin 1 Receptor Antagonist (IL1RA)

Sign In for Pricing
View Details
FITC-Linked Monoclonal Antibody to Interleukin 1 Receptor Antagonist (IL1RA)
TRV-0021897-02 200 µL

FITC-Linked Monoclonal Antibody to Interleukin 1 Receptor Antagonist (IL1RA)

Sign In for Pricing
View Details
MET, phosphorylated (Tyr1356) (HGF receptor, HGFR, Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, SF Receptor, HGF/SF Receptor, Tyrosine-Protein Kinase Met, Proto-Oncogene c-Met) (MaxLight 490) discontinued
M3007-13L-ML490 100 µL

MET, phosphorylated (Tyr1356) (HGF receptor, HGFR, Hepatocyte Growth Factor Receptor, Scatter Factor Receptor, SF Receptor, HGF/SF Receptor, Tyrosine-Protein Kinase Met, Proto-Oncogene c-Met) (MaxLight 490) discontinued

Sign In for Pricing
View Details
TRAF5 Rabbit Polyclonal Antibody (HRP)
orb2614979 100 µg

TRAF5 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
4- (1-Methyl-1H-pyrazol-4-yl) -8-oxa-2-azaspiro[4.5]decane
PZC06087-01 50 mg

4- (1-Methyl-1H-pyrazol-4-yl) -8-oxa-2-azaspiro[4.5]decane

Sign In for Pricing
View Details
4- (1-Methyl-1H-pyrazol-4-yl) -8-oxa-2-azaspiro[4.5]decane
PZC06087-02 0.5 g

4- (1-Methyl-1H-pyrazol-4-yl) -8-oxa-2-azaspiro[4.5]decane

Sign In for Pricing
View Details