Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMARCD2 Rabbit Polyclonal Antibody (HRP)

SMARCD2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SGD2, Rsc6p, BAF60B, CRACD2, PRO2451

UniProt

Q92925

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human SMARCD2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: STDPQDFIQEWLRSQRRDLKIITDVIGNPEEERRAAFYHQPWAQEAVGRH

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

54kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003068

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raptor (Regulatory Associated Protein of mTOR, p150 Target of Rapamycin (TOR) Scaffold Protein containing WD-repeats, KIAA1303) (PE)
MBS6244614-01 0.1 mL

Raptor (Regulatory Associated Protein of mTOR, p150 Target of Rapamycin (TOR) Scaffold Protein containing WD-repeats, KIAA1303) (PE)

Sign In for Pricing
View Details
Raptor (Regulatory Associated Protein of mTOR, p150 Target of Rapamycin (TOR) Scaffold Protein containing WD-repeats, KIAA1303) (PE)
MBS6244614-02 5x 0.1 mL

Raptor (Regulatory Associated Protein of mTOR, p150 Target of Rapamycin (TOR) Scaffold Protein containing WD-repeats, KIAA1303) (PE)

Sign In for Pricing
View Details
Anti-Foot-and-mouth disease virus serotype Asia-1 (FMDV) Genome polyprotein Antibody
DZ41867-carrier-free 200 µL/Vial

Anti-Foot-and-mouth disease virus serotype Asia-1 (FMDV) Genome polyprotein Antibody

Sign In for Pricing
View Details
Mouse H2bc22 qPCR Primer Pair
QM69866S 200 Tests

Mouse H2bc22 qPCR Primer Pair

Sign In for Pricing
View Details
Anti-Lamin A+C/LMNA Antibody Picoband® (monoclonal, 5F3C12) (Biotine Conjugate)
M00438-6-Biotin 100 µg/Vial

Anti-Lamin A+C/LMNA Antibody Picoband® (monoclonal, 5F3C12) (Biotine Conjugate)

Sign In for Pricing
View Details
IDO2/Indoleamine 2,3-dioxygenase 2 Mouse Monoclonal Antibody [Clone IDO2/2639]
MBS4381830-01 0.02 mg (With BSA & Azide at 0.2mg/mL)

IDO2/Indoleamine 2,3-dioxygenase 2 Mouse Monoclonal Antibody [Clone IDO2/2639]

Sign In for Pricing
View Details