Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP2 Rabbit Polyclonal Antibody (Biotin)

SP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

UniProt

Q02086

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SDPQTSMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVE

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003101

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS10 (40S Ribosomal Protein S10, Ribosomal Protein S10)
490891 100 µL

RPS10 (40S Ribosomal Protein S10, Ribosomal Protein S10)

Sign In for Pricing
View Details
Integrin beta 1 Rabbit mAb Antibody
orb1472115-01 50 μL

Integrin beta 1 Rabbit mAb Antibody

Sign In for Pricing
View Details
Integrin beta 1 Rabbit mAb Antibody
orb1472115-02 100 µL

Integrin beta 1 Rabbit mAb Antibody

Sign In for Pricing
View Details
Mouse anti- human Cyfra21-1(BM 19.21) monoclonal Antibody
MBS1495558-01 0.05 mg

Mouse anti- human Cyfra21-1(BM 19.21) monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti- human Cyfra21-1(BM 19.21) monoclonal Antibody
MBS1495558-02 0.1 mg

Mouse anti- human Cyfra21-1(BM 19.21) monoclonal Antibody

Sign In for Pricing
View Details
Mouse anti- human Cyfra21-1(BM 19.21) monoclonal Antibody
MBS1495558-03 5x 0.1 mg

Mouse anti- human Cyfra21-1(BM 19.21) monoclonal Antibody

Sign In for Pricing
View Details