Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP2 Rabbit Polyclonal Antibody (HRP)

SP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q02086

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDPQTSMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003101

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MURF2 (Muscle Specific Ring Finger 2, Muscle Specific RING Finger Protein 2, MURF-2, Ring Finger Protein 29, RNF29, Tripartite Motif Containing 55, Tripartite Motif Containing Protein 55, TRIM55) APC
MBS6386150-01 0.1 mL

MURF2 (Muscle Specific Ring Finger 2, Muscle Specific RING Finger Protein 2, MURF-2, Ring Finger Protein 29, RNF29, Tripartite Motif Containing 55, Tripartite Motif Containing Protein 55, TRIM55) APC

Sign In for Pricing
View Details
MURF2 (Muscle Specific Ring Finger 2, Muscle Specific RING Finger Protein 2, MURF-2, Ring Finger Protein 29, RNF29, Tripartite Motif Containing 55, Tripartite Motif Containing Protein 55, TRIM55) APC
MBS6386150-02 5x 0.1 mL

MURF2 (Muscle Specific Ring Finger 2, Muscle Specific RING Finger Protein 2, MURF-2, Ring Finger Protein 29, RNF29, Tripartite Motif Containing 55, Tripartite Motif Containing Protein 55, TRIM55) APC

Sign In for Pricing
View Details
Recombinant Human ACRV1 Protein
CRP1009-01 10 µg

Recombinant Human ACRV1 Protein

Sign In for Pricing
View Details
Recombinant Human ACRV1 Protein
CRP1009-02 50 µg

Recombinant Human ACRV1 Protein

Sign In for Pricing
View Details
Recombinant Human ACRV1 Protein
CRP1009-03 500 µg

Recombinant Human ACRV1 Protein

Sign In for Pricing
View Details
Rabbit Anti CD36 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,ELISA) 200ul
IRBAMLCD36AP662200UL 200 µL

Rabbit Anti CD36 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 0.5% BSA and 50% glycerol, pH7.4) (Western Blot,ELISA) 200ul

Sign In for Pricing
View Details