Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SP2 Rabbit Polyclonal Antibody (HRP)

SP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q02086

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: SDPQTSMAATAAVSPSDYLQPAASTTQDSQPSPLALLAATCSKIGPPAVE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003101

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANXA7 (Synexin, Annexin VII, Annexin-7, Annexin A7, ANX7, SNX, OK/SW-cl.95) (AP) discontinued
137551-AP 100 µL

ANXA7 (Synexin, Annexin VII, Annexin-7, Annexin A7, ANX7, SNX, OK/SW-cl.95) (AP) discontinued

Sign In for Pricing
View Details
Cyanidin-3-O-glucoside chloride
S9312-1mg 1 mg

Cyanidin-3-O-glucoside chloride

Sign In for Pricing
View Details
RGD1564071 3'UTR GFP Stable Cell Line
TU268880 1.0 mL

RGD1564071 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MAST1 Rabbit Polyclonal Antibody (Biotin)
orb2090989 100 µL

MAST1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
NOS I (nNOS, bNOS, Nitric Oxide Synthase, NOS 1)
N5350-01G 100 µL

NOS I (nNOS, bNOS, Nitric Oxide Synthase, NOS 1)

Sign In for Pricing
View Details
SOX12 Protein Vector (Human) (pPB-C-His)
PV132738 500 ng

SOX12 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details