Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SSRP1 Rabbit Polyclonal Antibody (FITC)

SSRP1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

FACT, T160, FACT80

UniProt

Q08945

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SSRP1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTE

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

81kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_003137

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eukaryotic translation initiation factor 3 subunit A
orb1642245-01 50 µg

Eukaryotic translation initiation factor 3 subunit A

Sign In for Pricing
View Details
Eukaryotic translation initiation factor 3 subunit A
orb1642245-02 100 µg

Eukaryotic translation initiation factor 3 subunit A

Sign In for Pricing
View Details
Eukaryotic translation initiation factor 3 subunit A
orb1642245-03 1 mg

Eukaryotic translation initiation factor 3 subunit A

Sign In for Pricing
View Details
Rabbit anti LSP1, Phosphospecific
MBS462231-01 0.1 mg

Rabbit anti LSP1, Phosphospecific

Sign In for Pricing
View Details
Rabbit anti LSP1, Phosphospecific
MBS462231-02 5x 0.1 mg

Rabbit anti LSP1, Phosphospecific

Sign In for Pricing
View Details
Human thymidylate synthetase ELISA Kit
ELA-E0949h 96 Tests

Human thymidylate synthetase ELISA Kit

Sign In for Pricing
View Details