Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAT3 Rabbit Polyclonal Antibody (HRP)

STAT3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

APRF, HIES, ADMIO, ADMIO1

UniProt

B5BTZ6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human STAT3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: AQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKES

Field of Research

Cancer Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

88kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

IF, IHC, WB

NCBI Accession Number

NP_003141

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 4, Recombinant, Rat (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) discontinued
I8426-26B-01 2 µg

Interleukin 4, Recombinant, Rat (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) discontinued

Sign In for Pricing
View Details
Interleukin 4, Recombinant, Rat (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) discontinued
I8426-26B-02 10 µg

Interleukin 4, Recombinant, Rat (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) discontinued

Sign In for Pricing
View Details
NFkB-p65, phosphorylated (T254) (p65, p65 NF kappaB, p65 NFkB, RELA, NFKB P65, Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, NFkB-p65, NFKB3) discontinued
224525-01 50 µL

NFkB-p65, phosphorylated (T254) (p65, p65 NF kappaB, p65 NFkB, RELA, NFKB P65, Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, NFkB-p65, NFKB3) discontinued

Sign In for Pricing
View Details
NFkB-p65, phosphorylated (T254) (p65, p65 NF kappaB, p65 NFkB, RELA, NFKB P65, Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, NFkB-p65, NFKB3) discontinued
224525-02 100 µL

NFkB-p65, phosphorylated (T254) (p65, p65 NF kappaB, p65 NFkB, RELA, NFKB P65, Transcription Factor p65, Nuclear Factor NF-kappa-B p65 Subunit, NFkB-p65, NFKB3) discontinued

Sign In for Pricing
View Details
4-Cyanoindole
HY-W007669-01 1 g

4-Cyanoindole

Sign In for Pricing
View Details
4-Cyanoindole
HY-W007669-02 5 g

4-Cyanoindole

Sign In for Pricing
View Details