Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT4H1 Rabbit Polyclonal Antibody (HRP)

SUPT4H1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SPT4, SPT4H, SUPT4H, Supt4a

UniProt

P63272

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SUPT4H1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: NCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003159

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIN-m5F Cell Complete Medium
CM-0423 4x 125 mL

RIN-m5F Cell Complete Medium

Sign In for Pricing
View Details
IL12RB1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-2603R-BF488-01 20 µL

IL12RB1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
IL12RB1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-2603R-BF488-02 100 µL

IL12RB1 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
CLEC11A CRISPR All-in-one AAV vector set (with saCas9)(Rat)
16293156 3x 1.0 µg DNA

CLEC11A CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Human Fibulin 1 (FBLN1) CLIA Kit
MBS2709091-01 24 Strip Well

Human Fibulin 1 (FBLN1) CLIA Kit

Sign In for Pricing
View Details
Human Fibulin 1 (FBLN1) CLIA Kit
MBS2709091-02 48 Well

Human Fibulin 1 (FBLN1) CLIA Kit

Sign In for Pricing
View Details