Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SUPT6H Rabbit Polyclonal Antibody (FITC)

SUPT6H Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

SPT6, SPT6H, emb-5

UniProt

Q7KZ85

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SUPT6H

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: EAEESEEEYNDEGEVVPRVTKKFVEEEDDDEEEEEENLDDQDEQGNLKGF

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

199kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

IHC, WB

NCBI Accession Number

NP_003161

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Bcl2 (3H5) Mouse Monoclonal Antibody
MA1431-.1 100 µL

Anti-Bcl2 (3H5) Mouse Monoclonal Antibody

Sign In for Pricing
View Details
COL4A3 ORF Vector (Human) (pORF)
16580011 1.0 µg DNA

COL4A3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Mouse Anti Human Natural Cytotoxicity Receptor NKp46
MBS140187-01 0.005 mg

Mouse Anti Human Natural Cytotoxicity Receptor NKp46

Sign In for Pricing
View Details
Mouse Anti Human Natural Cytotoxicity Receptor NKp46
MBS140187-02 0.02 mg

Mouse Anti Human Natural Cytotoxicity Receptor NKp46

Sign In for Pricing
View Details
Mouse Anti Human Natural Cytotoxicity Receptor NKp46
MBS140187-03 0.1 mg

Mouse Anti Human Natural Cytotoxicity Receptor NKp46

Sign In for Pricing
View Details
Mouse Anti Human Natural Cytotoxicity Receptor NKp46
MBS140187-04 5x 0.1 mg

Mouse Anti Human Natural Cytotoxicity Receptor NKp46

Sign In for Pricing
View Details