Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF3 Rabbit Polyclonal Antibody (Biotin)

TCF3 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

E2A, E47, p75, AGM8, ITF1, VDIR, TCF-3, bHLHb21

UniProt

P15923

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TCF3

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGL

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

68kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003191

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Angiotensin II (3-8), human
5-00689 4x 5 mg

Angiotensin II (3-8), human

Sign In for Pricing
View Details
Rabbit Polyclonal FAM123A Antibody [mFluor Violet 500 SE]
NBP3-05964MFV500 0.1 mL

Rabbit Polyclonal FAM123A Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF488A conjugate, 0.1mg/mL
BNC881969-100 1x 100 µL

Thyroglobulin (Thyroidal Cell Marker) (r6E1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO1 Antibody
E312082 200 µL

SUMO1 Antibody

Sign In for Pricing
View Details
Zfp53 (NM_013843) Mouse Tagged ORF Clone
MG209775 10 µg

Zfp53 (NM_013843) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ethyl 3-fur-2-yl-3-oxopropanoate
sc-263233A 5 g

Ethyl 3-fur-2-yl-3-oxopropanoate

Sign In for Pricing
View Details