Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCF21 Rabbit Polyclonal Antibody (HRP)

TCF21 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

POD1, bHLHa23

UniProt

O43680

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human TCF21

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RQILANDKYENGYIHPVNLTWPFMVAGKPESDLKEVVTASRLCGTTAS

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

20kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003197

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SIPA1L2 activation kit by CRISPRa
GA111595 1 Kit

Human SIPA1L2 activation kit by CRISPRa

Sign In for Pricing
View Details
Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF568 conjugate, 0.1mg/mL
BNC681857-100 1x 100 µL

Beta-2 Microglobulin (Renal Failure & Tumor Marker) (B2M/1857R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF405S conjugate, 0.1mg/mL
BNC042397-500 1x 500 µL

CD14 (Monocyte / Macrophage Marker) (LPSR/2397), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
D-Gln(7)-Terlipressin Trifluoroacetic Acid Salt
TRC-G410180-10MG 10 mg

D-Gln(7)-Terlipressin Trifluoroacetic Acid Salt

Sign In for Pricing
View Details
MSH6 (DNA Mismatch Repair Protein) (MSH6/3091), CF594 conjugate, 0.1mg/mL
BNC943091-100 1x 100 µL

MSH6 (DNA Mismatch Repair Protein) (MSH6/3091), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Siglecg Mouse Gene Knockout Kit (CRISPR)
KN515781 1 Kit

Siglecg Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details