Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TFAP2B Rabbit Polyclonal Antibody (FITC)

TFAP2B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PDA2, AP-2B, AP2-B, AP-2beta

UniProt

Q92481

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TFAP2B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MHSPPRDQAAIMLWKLVENVKYEDIYEDRHDGVPSHSSRLSQLGSVSQGP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003212

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLIA kit for Human ELA3B (Elastase 3B)
E-CL-H0882 96 Tests

CLIA kit for Human ELA3B (Elastase 3B)

Sign In for Pricing
View Details
Recombinant Bacillus thuringiensis Formate--tetrahydrofolate ligase (fhs), partial
MBS1020592 Inquire

Recombinant Bacillus thuringiensis Formate--tetrahydrofolate ligase (fhs), partial

Sign In for Pricing
View Details
UBL4A (Ubiquitin-Like 4A, DX254E, DXS254E, G6PD, GDX, UBL4) (MaxLight 650)
135030-ML650 100 µL

UBL4A (Ubiquitin-Like 4A, DX254E, DXS254E, G6PD, GDX, UBL4) (MaxLight 650)

Sign In for Pricing
View Details
CD200, CT (CD200, MOX1, MOX2, OX-2 membrane glycoprotein, CD200) (MaxLight 490) discontinued
033474-ML490 100 µL

CD200, CT (CD200, MOX1, MOX2, OX-2 membrane glycoprotein, CD200) (MaxLight 490) discontinued

Sign In for Pricing
View Details
RUNX2 (Runt-related Transcription Factor 2, Core-binding Factor Subunit alpha-1, CBF-alpha-1, Acute Myeloid Leukemia 3 Protein, Oncogene AML-3, Polyomavirus Enhancer-binding Protein 2 alpha A Subunit, PEBP2-alpha A, PEA2-alpha A, SL3-3 Enhancer Factor 1 alpha A Subunit, SL3/AKV Core-binding Factor alpha A Subunit, Osteoblast-specific Transcription Factor 2, OSF-2, AML3, CBFA1, OSF2, PEBP2A)
132895 100 µg

RUNX2 (Runt-related Transcription Factor 2, Core-binding Factor Subunit alpha-1, CBF-alpha-1, Acute Myeloid Leukemia 3 Protein, Oncogene AML-3, Polyomavirus Enhancer-binding Protein 2 alpha A Subunit, PEBP2-alpha A, PEA2-alpha A, SL3-3 Enhancer Factor 1 alpha A Subunit, SL3/AKV Core-binding Factor alpha A Subunit, Osteoblast-specific Transcription Factor 2, OSF-2, AML3, CBFA1, OSF2, PEBP2A)

Sign In for Pricing
View Details
NUB1/NYREN18 Rabbit Polyclonal Antibody (RBITC)
orb1076248 100 µL

NUB1/NYREN18 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details