Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TULP2 Rabbit Polyclonal Antibody (HRP)

TULP2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

CT65, TUBL2

UniProt

O00295

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TULP2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSQDNDTLMRDILGHELAAMRLQKLEQQRRLFEKKQRQKRQELLMVQANP

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

59kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_003314

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD99 (CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X, CD99 antigen, 12E7, E2 antigen, Protein MIC2, T-cell surface glycoProtein E2) (MaxLight 550)
MBS6410542-01 0.1 mL

CD99 (CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X, CD99 antigen, 12E7, E2 antigen, Protein MIC2, T-cell surface glycoProtein E2) (MaxLight 550)

Sign In for Pricing
View Details
CD99 (CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X, CD99 antigen, 12E7, E2 antigen, Protein MIC2, T-cell surface glycoProtein E2) (MaxLight 550)
MBS6410542-02 5x 0.1 mL

CD99 (CD99, HBA71, MIC2, MIC2X, MIC2Y, MSK5X, CD99 antigen, 12E7, E2 antigen, Protein MIC2, T-cell surface glycoProtein E2) (MaxLight 550)

Sign In for Pricing
View Details
Histone H3 (Acetyl Lys27) discontinued
347382-01 100 µL

Histone H3 (Acetyl Lys27) discontinued

Sign In for Pricing
View Details
Histone H3 (Acetyl Lys27) discontinued
347382-02 200 µL

Histone H3 (Acetyl Lys27) discontinued

Sign In for Pricing
View Details
Mouse Zfp512 Pre-designed siRNA Set B
SI116449B 1 Each

Mouse Zfp512 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SMN2 (Survival of Motor Neuron 2, Centromeric, BCD541, C-BCD541, FLJ76644, MGC20996, MGC5208, SMNC)
251866 100 µg

SMN2 (Survival of Motor Neuron 2, Centromeric, BCD541, C-BCD541, FLJ76644, MGC20996, MGC5208, SMNC)

Sign In for Pricing
View Details