Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TULP3 Rabbit Polyclonal Antibody (HRP)

TULP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

TUBL3

UniProt

O75386

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human TULP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKRQRKKRLEPFMVQPNPEARLRRAKPRASDEQTPLVNCHTPHSNVILHG

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003315

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human ANKRD11 sgRNA gene knockout kit - Lentiviral human ANKRD11 sgRNA gene knockout kit (plasmid)
GTR15400010 1 Vial

Lentiviral human ANKRD11 sgRNA gene knockout kit - Lentiviral human ANKRD11 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
Capsid protein VP1 Antibody, HRP conjugated
CSB-PA362102LB01HPM-01 50 µg

Capsid protein VP1 Antibody, HRP conjugated

Sign In for Pricing
View Details
Capsid protein VP1 Antibody, HRP conjugated
CSB-PA362102LB01HPM-02 100 µg

Capsid protein VP1 Antibody, HRP conjugated

Sign In for Pricing
View Details
CBX3P1 ORF Vector (Human) (pORF)
ORF016903 1.0 µg DNA

CBX3P1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Tinagl1 Rabbit Polyclonal Antibody (FITC)
orb462701 100 µL

Tinagl1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Mometasone furoate
orb1308297-01 25 mg

Mometasone furoate

Sign In for Pricing
View Details