Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFX Rabbit Polyclonal Antibody (HRP)

ZFX Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF926

UniProt

P17010

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZFX

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MDEDGLELQQEPNSFFDATGADGTHMDGDQIVVEVQETVFVSDVVDSDIT

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

90kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_003401

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFATC2, phosphorylated (Ser330) (Nuclear Factor Of Activated T-cells, Cytoplasmic 2, NF-ATc2, NFATc2, T-cell Transcription Factor NFAT1, NFAT Pre-existing Subunit, NF-ATp, NFAT1, NFATP) (Azide free) (HRP) discontinued
N2375-20A-HRP 200 µL

NFATC2, phosphorylated (Ser330) (Nuclear Factor Of Activated T-cells, Cytoplasmic 2, NF-ATc2, NFATc2, T-cell Transcription Factor NFAT1, NFAT Pre-existing Subunit, NF-ATp, NFAT1, NFATP) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
OR2T3/OR2T34 Antibody
MBS7119643-01 0.05 mg

OR2T3/OR2T34 Antibody

Sign In for Pricing
View Details
OR2T3/OR2T34 Antibody
MBS7119643-02 0.1 mg

OR2T3/OR2T34 Antibody

Sign In for Pricing
View Details
OR2T3/OR2T34 Antibody
MBS7119643-03 5x 0.1 mg

OR2T3/OR2T34 Antibody

Sign In for Pricing
View Details
Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit α (FNTA) Rat ELISA Kit
G3322 96 Tests

Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit α (FNTA) Rat ELISA Kit

Sign In for Pricing
View Details
SCD1 Rabbit mAb
MBS8603408-01 0.1 mL

SCD1 Rabbit mAb

Sign In for Pricing
View Details