Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZFX Rabbit Polyclonal Antibody (Biotin)

ZFX Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF926

UniProt

P17010

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZFX

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: QCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKGFRRPSEKNQHIMR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R9A (Neurabin-1, Neurabin-I, Neural Tissue-specific F-actin-binding Protein I, Protein Phosphatase 1 Regulatory Subunit 9A, KIAA1222, FLJ20068) (MaxLight 405)
MBS6191963-01 0.1 mL

PPP1R9A (Neurabin-1, Neurabin-I, Neural Tissue-specific F-actin-binding Protein I, Protein Phosphatase 1 Regulatory Subunit 9A, KIAA1222, FLJ20068) (MaxLight 405)

Sign In for Pricing
View Details
PPP1R9A (Neurabin-1, Neurabin-I, Neural Tissue-specific F-actin-binding Protein I, Protein Phosphatase 1 Regulatory Subunit 9A, KIAA1222, FLJ20068) (MaxLight 405)
MBS6191963-02 5x 0.1 mL

PPP1R9A (Neurabin-1, Neurabin-I, Neural Tissue-specific F-actin-binding Protein I, Protein Phosphatase 1 Regulatory Subunit 9A, KIAA1222, FLJ20068) (MaxLight 405)

Sign In for Pricing
View Details
TACC3 Antibody
F53872-0.05ML 0.05 mL

TACC3 Antibody

Sign In for Pricing
View Details
NP-5 (alpha Defensin-5, HNP-5)
N5378-07K 100 µg

NP-5 (alpha Defensin-5, HNP-5)

Sign In for Pricing
View Details
Rubella virus/RUBV Poly Protein (N-His, Rubella virus (RUBV) )
P507967 100 µg

Rubella virus/RUBV Poly Protein (N-His, Rubella virus (RUBV) )

Sign In for Pricing
View Details
FUBP1  polyclonal antibody
BS74902 50ul

FUBP1 polyclonal antibody

Sign In for Pricing
View Details