Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF74 Rabbit Polyclonal Antibody (FITC)

ZNF74 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

COS52, hZNF7, ZFP520, ZNF520

UniProt

Q16587

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF74

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: VISHLERGEEPWSMQREVPRGPCPEWELKAVPSQQQGICKEEPAQEPIME

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Mycoplasma pneumoniae (strain 29342/M129) pepA Polyclonal Antibody
MBS7148664 Inquire

Rabbit anti-Mycoplasma pneumoniae (strain 29342/M129) pepA Polyclonal Antibody

Sign In for Pricing
View Details
Solute carrier family 22 member 2 (SLC22A2) Mouse ELISA Kit
H2065 96 Tests

Solute carrier family 22 member 2 (SLC22A2) Mouse ELISA Kit

Sign In for Pricing
View Details
Gpr111 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
22485114 3x 1.0 µg

Gpr111 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
UCP1 Antibody
orb19218 100 µg

UCP1 Antibody

Sign In for Pricing
View Details
CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (FITC) discontinued
C2254-60-FITC 100 µL

CD3 (Early T Cell Marker, T Cell receptor Complex, TCR) (FITC) discontinued

Sign In for Pricing
View Details
EOMES Human Over-expression Lysate
orb1357567 100 µg

EOMES Human Over-expression Lysate

Sign In for Pricing
View Details