Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF74 Rabbit Polyclonal Antibody (HRP)

ZNF74 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

COS52, hZNF7, ZFP520, ZNF520

UniProt

Q16587

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human ZNF74

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: VISHLERGEEPWSMQREVPRGPCPEWELKAVPSQQQGICKEEPAQEPIME

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

63kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pki γ CRISPR/Cas9 KO Plasmid (h)
sc-411573 20 µg

Pki γ CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Rabbit anti-DCPS Antibody, Affinity Purified
MBS3905578-01 0.01 mg

Rabbit anti-DCPS Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DCPS Antibody, Affinity Purified
MBS3905578-02 0.1 mg

Rabbit anti-DCPS Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DCPS Antibody, Affinity Purified
MBS3905578-03 5x 0.01 mg

Rabbit anti-DCPS Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DCPS Antibody, Affinity Purified
MBS3905578-04 5x 0.1 mg

Rabbit anti-DCPS Antibody, Affinity Purified

Sign In for Pricing
View Details
GPC4 Antibody (Center)
E45R31993G-4 50 µL

GPC4 Antibody (Center)

Sign In for Pricing
View Details