Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL1, Human (His)

The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N (7) -methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

METTL1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mettl1-protein-human-his.html

Purity

98.0

Smiles

DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ

Molecular Formula

4234 (Gene_ID) Q9UBP6-1/NP_005362.3 (D32-Q265) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PGK1/PGKA Protein (His Tag)
PKSH032892-01 10 µg

Recombinant Human PGK1/PGKA Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PGK1/PGKA Protein (His Tag)
PKSH032892-02 50 µg

Recombinant Human PGK1/PGKA Protein (His Tag)

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF405S conjugate, 0.1mg/mL
BNC041887-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/1887R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
3-Chloro-4-morpholino-1,2,5-thiadiazole
TRC-C379960-500MG 500 mg

3-Chloro-4-morpholino-1,2,5-thiadiazole

Sign In for Pricing
View Details
Rem2 Mouse Monoclonal Antibody [B4-D6]
M1403-1 100 µL

Rem2 Mouse Monoclonal Antibody [B4-D6]

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-1010-01 50 μL

DNAJB1 Antibody

Sign In for Pricing
View Details