Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

METTL1, Human (His)

The METTL1 protein is a catalytic component of the METTL1-WDR4 methyltransferase complex, which promotes the formation of N (7) -methylguanine in tRNA, mRNA, and miRNA. METTL1 Protein, Human (His) is the recombinant human-derived METTL1 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

METTL1 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mettl1-protein-human-his.html

Purity

98.0

Smiles

DHTLRYPVKPEEMDWSELYPEFFAPLTQNQSHDDPKDKKEKRAQAQVEFADIGCGYGGLLVELSPLFPDTLILGLEIRVKVSDYVQDRIRALRAAPAGGFQNIACLRSNAMKHLPNFFYKGQLTKMFFLFPDPHFKRTKHKWRIISPTLLAEYAYVLRVGGLVYTITDVLELHDWMCTHFEEHPLFERVPLEDLSEDPVVGHLGTSTEEGKKVLRNGGKNFPAIFRRIQDPVLQ

Molecular Formula

4234 (Gene_ID) Q9UBP6-1/NP_005362.3 (D32-Q265) (Accession)

Molecular Weight

Approximately 30 kDa

Shipping Conditions

Dry ice

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-Amino-1-(4-bromophenyl)-1-ethanol
TRC-A576608-100MG 100 mg

2-Amino-1-(4-bromophenyl)-1-ethanol

Sign In for Pricing
View Details
Atp6ap1l sgRNA CRISPR Lentivector set (Mouse)
K3214601 3x 1.0 µg

Atp6ap1l sgRNA CRISPR Lentivector set (Mouse)

Sign In for Pricing
View Details
Ceftobiprole Impurity 39
RM-C753039-01 10 mg

Ceftobiprole Impurity 39

Sign In for Pricing
View Details
Ceftobiprole Impurity 39
RM-C753039-02 25 mg

Ceftobiprole Impurity 39

Sign In for Pricing
View Details
Ceftobiprole Impurity 39
RM-C753039-03 50 mg

Ceftobiprole Impurity 39

Sign In for Pricing
View Details
Ceftobiprole Impurity 39
RM-C753039-04 100 mg

Ceftobiprole Impurity 39

Sign In for Pricing
View Details