Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF76 Rabbit Polyclonal Antibody (FITC)

ZNF76 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZNF523, Zfp523, D6S229E

UniProt

P36508

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF76

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LSDGTTAYVQQAVKGEKLLEGQVIQLEDGTTAYIHQVTVQKEALSFEDGQ

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

62kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003418

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDTL rabbit pAb Antibody
orb2305559-01 50 µL

DDTL rabbit pAb Antibody

Sign In for Pricing
View Details
DDTL rabbit pAb Antibody
orb2305559-02 100 µL

DDTL rabbit pAb Antibody

Sign In for Pricing
View Details
ZNF215 (Zinc Finger Protein 215, BAZ2, ZKSCAN11) (AP)
MBS6162527-01 0.1 mL

ZNF215 (Zinc Finger Protein 215, BAZ2, ZKSCAN11) (AP)

Sign In for Pricing
View Details
ZNF215 (Zinc Finger Protein 215, BAZ2, ZKSCAN11) (AP)
MBS6162527-02 5x 0.1 mL

ZNF215 (Zinc Finger Protein 215, BAZ2, ZKSCAN11) (AP)

Sign In for Pricing
View Details
Mouse Monoclonal epithelial Sodium Channel gamma Antibody (11-35-1) [DyLight 594]
NBP2-41374DL594 0.1 mL

Mouse Monoclonal epithelial Sodium Channel gamma Antibody (11-35-1) [DyLight 594]

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis ubiE Protein (aa 1-229) (strain UCH-1/proctitis)
VAng-Lsx7354-1mgEcoli 1 mg (E. coli)

Recombinant Chlamydophila Trachomatis ubiE Protein (aa 1-229) (strain UCH-1/proctitis)

Sign In for Pricing
View Details