Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF124 Rabbit Polyclonal Antibody (Biotin)

ZNF124 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZK7, HZF16, HZF-16

UniProt

Q15973

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF124

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MSGHPGSWEMNSVAFEDVAVNFTQEEWALLDPSQKNLYRDVMQETFRNLA

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-U6-Maoa-shRNA1-CopGFP-Puro Plasmid
PVT51213 2 µg

pLV3-U6-Maoa-shRNA1-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
PLEKHB1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
36983111 3x 1.0 µg

PLEKHB1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal Abraxas Antibody [Alexa Fluor 488]
NBP1-22978AF488 0.1 mL

Rabbit Polyclonal Abraxas Antibody [Alexa Fluor 488]

Sign In for Pricing
View Details
GLRA1 (Glycine Receptor 48kD Subunit, Glycine receptor strychnine-binding subunit, Glycine Receptor Subunit alpha 1) (MaxLight 650)
127351-ML650 100 µL

GLRA1 (Glycine Receptor 48kD Subunit, Glycine receptor strychnine-binding subunit, Glycine Receptor Subunit alpha 1) (MaxLight 650)

Sign In for Pricing
View Details
Sec5 (m) -PR
sc-153316-PR 10 µM - 20 µL

Sec5 (m) -PR

Sign In for Pricing
View Details
Remdesivir Impurity 14
RM-R051314-01 10 mg

Remdesivir Impurity 14

Sign In for Pricing
View Details