Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF124 Rabbit Polyclonal Antibody (HRP)

ZNF124 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZK7, HZF16, HZF-16

UniProt

Q15973

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF124

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: MSGHPGSWEMNSVAFEDVAVNFTQEEWALLDPSQKNLYRDVMQETFRNLA

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

33kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Canine, Equine, Human, Mouse, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_003422

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC Anti-Human CD55 Antibody [HI55a]
MBS2578872-01 20 Tests

FITC Anti-Human CD55 Antibody [HI55a]

Sign In for Pricing
View Details
FITC Anti-Human CD55 Antibody [HI55a]
MBS2578872-02 100 Tests

FITC Anti-Human CD55 Antibody [HI55a]

Sign In for Pricing
View Details
FITC Anti-Human CD55 Antibody [HI55a]
MBS2578872-03 2x 100 Tests

FITC Anti-Human CD55 Antibody [HI55a]

Sign In for Pricing
View Details
FITC Anti-Human CD55 Antibody [HI55a]
MBS2578872-04 10x 100 Tests

FITC Anti-Human CD55 Antibody [HI55a]

Sign In for Pricing
View Details
Recombinant Shigella Sonnei ospG Protein (aa 1-196)
VAng-Lsx09971-1mgEcoli 1 mg (E. coli)

Recombinant Shigella Sonnei ospG Protein (aa 1-196)

Sign In for Pricing
View Details
SIRT2 Polyclonal Antibody
A-4702-100 100 µL

SIRT2 Polyclonal Antibody

Sign In for Pricing
View Details